Welcome to DeepRab

A webserver for classifying the molecular functions of Rab GTPase using Deep Learning

Introduction

Rab protein is a member of monomeric G-protein, which regulates numerous essential process in the cell. Rab proteins were usually bound with GTP binding sites to perform various functions in biology molecules. According to the functional role in membrane trafficking and cell physiology, Rab proteins could be classified into four classes, they are Rab GDP-dissociation inhibitor (GDI) activity, Rab geranylgeranyltransferase activity (GGT), Rab GTPase binding, Rab guanyl-nucleotide exchange factor activity. Fig. 1 shows the process of Rab cycle including all the molecular functions. Rab GGT plays the role as an enzyme in Rab system to transfer the geranylgeranyl and deliver the Rab to its target membrane. GDI activity prevents the association of GTP binding in Rab proteins system, so that keeps the Rab proteins in inactive state. Rab GEF activity stimulates the exchange of GDP to GTP binding sites to activate the Rab. Under normal condition, the priority of GTP is higher than GDP, then Rab GEF activity is activated to replace GDP by GTP. A GTPase binding aims to interact Rab with the binding sites and molecules and thereby convert the Rab back to its inactive state. The Rab then interacts with GTPase activating protein (GAP) and removed from the membrane via GDI.

Numerous types of Rab proteins now identified in human and several studies demonstrated that a functional loss of Rab proteins at each of the membrane trafficking steps had been implicated in many diseases i.e., choroideremia, intellectual disability, cancer, Parkinson’s disease. For instance, the modulation of Rab GGT molecular function has been related to Hermansky-Pudlak syndrome. The Rab GGT also used to develop some drug targets related to bone diseases, such as osteoporosis. Mutations in the Rab3GAP, which is a human class of the GAP process lead to X-linked nonspecific mental retardation, Warburg Micro and Martsolf syndromes, diseases characterized by developmental abnormalities of the eye, nervous system, and genitalia. A Rab GEF has also been implicated in human disease. Thus classification of Rab protein is a crucial topic and there is a requirement to develop some computational techniques to identify them.

Method

We approached a precise model using 2D CNN and PSSM profiles to classify the Rabs molecular functions in membrane trafficking. The flowchart of the study included four subprocesses: data collection, feature set generation, CNN generation and model evaluation. We describe the details of the proposed approach as follows.

Dataset

All the dataset using in this web server are retrieved from UniProt and GeneOntoly. The detail of the dataset lists in the below table.

Original BLAST 30% Cross-validation Independent
GDP-dissociation inhibitor 2060 169 141 28
geranylgeranyltransferase 1882 185 155 30
GTPase binding 10014 2694 2157 431
guanyl-nucleotide exchange factor 3136 630 525 105

If you would like to build a model and evaluate our model, we provide the dataset as the below link.

Download dataset.zip

Submission

In order to avoid the errors, please submit the sequence in fasta format (we also give you the fasta file examples). The user can choose two options to submit, including paste the sequence into text area and upload sequence file. The user can submit one single fasta file or multiple fasta file. In the result page, the probabilities will be shown to help people choosing which protein belongs to the corresponding complex of electron transport chain.

Sample fasta Sequence(s)

>sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1
MAPDPVAAKTPVQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYDISEFTRRHPGGSRVIS
HYAGQDATDPFVAFHSNKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVE
QMGLMKANHVFFLLYLLHILLLDGAAWLTLWIFGTSFLPFLLCAVLLTAAQIQAGWLQHD
LGHLSVFSTSKWNHLVHHFVIGHLKGVPASWWNHMHFQHHAKPNCFGKDPDINMHPFFFA
LGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALVPFFFQWYVFYFVIQRKKWVDLAWMI
TFYIRLLLTYVPLLGLKAFLGLYFIVRFLESNWFVWVTQMNHIPMHIDHDRNMDWVSTQL
QATCNVHKSAFNDWFSGHLNFQIEHHLFPMMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL
SAFADIIHSLKESGQLWLDAYLHQ
>O06873|SwissProt|Inner membrane integral membrane protein|Chemotaxis pomA protein
MDLATLLGLIGGFAFVIMAMVLGGSIGMFVDVTSILIVVGGSIFVVLMKFTMGQFFGATK
IAGKAFMFKADEPEDLIAKIVEMADAARKGGFLALEEMEINNTFMQKGIDLLVDGHDADV
VRAALKKDIALTDERHTQGTGVFRAFGDVAPAMGMIGTLVGLVAMLSNMDDPKAIGPAMA
VALLTTLYGAILSNMVFFPIADKLSLRRDQETLNRRLIMDGVLAIQDGQNPRVIDSYLKN
YLNEGKRALEIDE

Members

Yu-Yen Ou Assistant Professor

Department of Computer Science and Engineering
Yuan Ze University
135 Yuan-Tung Road, Chung-Li, Taiwan 32003, R.O.C.

Nguyen-Quoc-Khanh Le Research Scholar

Department of Computer Science and Engineering
Yuan Ze University
135 Yuan-Tung Road, Chung-Li, Taiwan 32003, R.O.C.

Quang-Thai Ho Research Scholar

Department of Computer Science and Engineering
Yuan Ze University
135 Yuan-Tung Road, Chung-Li, Taiwan 32003, R.O.C.

Contact us

Yuan Ze University
Department of Computer Science and Engineering
Graduate Program in Biomedical Informatics
Bioinformatics Laboratory (R1607B)
Address: No. 135, Yuandong Road, Chungli City, Taoyuan County, Taiwan R.O.C .32003
Tel: (03) 463-8800

If you have any problem or suggest any idea for our website, feel free to contact us via email: [email protected]